PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G30432.1
Common NameT6B20, TCL1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 84aa    MW: 10494 Da    PI: 9.2388
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G30432.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29e-093574445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ +  ++ G + W++Iar++  gR +k++  +w 
      AT2G30432.1 35 MTEQEEDLIFRMYRLVGDR-WDLIARRVV-GREAKEIERYWI 74
                     7****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.1E-43179IPR001005SANT/Myb domain
CDDcd001671.93E-53473No hitNo description
Gene3DG3DSA:1.10.10.601.1E-93574IPR009057Homeodomain-like
PfamPF002497.8E-83574IPR001005SANT/Myb domain
SuperFamilySSF466896.32E-73674IPR009057Homeodomain-like
PROSITE profilePS500906.1333673IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:2000039Biological Processregulation of trichome morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MDNTNRLRRL HCHKQPKFTH SSQEVSSMKW EFINMTEQEE DLIFRMYRLV GDRWDLIARR  60
VVGREAKEIE RYWIMRNCDY FSHK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.495561e-85silique
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT2G30432
AtGenExpressAT2G30432
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in inflorescences and trichomes of rosette and cauline leaves. {ECO:0000269|PubMed:20622149}.
Functional Description ? help Back to Top
Source Description
TAIREncodes TRICHOMELESS1 (TCL1), a single-repeat MYB-type transcription factor that negatively regulates trichome formation by suppressing GL1 (GLABRA1). In a tandem repeat with AT2g30424 and AT2g30420.
UniProtMYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269|PubMed:17933793}.
Function -- GeneRIF ? help Back to Top
  1. TRICHOMELESS1 can be recruited to the cis-acting regulatory elements of GLABRA1
    [PMID: 17933793]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G30432.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT2G42200 (A)
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G27920(R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Trichome formation on inflorescence stems and pedicels. {ECO:0000269|PubMed:17933793}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G30432
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1087771e-140DQ108777.1 Arabidopsis thaliana clone 22671 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031445.12e-58protein trichomeless 1
SwissprotD3GKW63e-60TCL1_ARATH; MYB-like transcription factor TCL1
TrEMBLD3GKW73e-57D3GKW7_ARATH; Trichomeless1
STRINGAT2G30432.18e-58(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Representative plantOGRP4207823
Publications ? help Back to Top
  1. Wang S, et al.
    TRICHOMELESS1 regulates trichome patterning by suppressing GLABRA1 in Arabidopsis.
    Development, 2007. 134(21): p. 3873-82
    [PMID:17933793]
  2. Hilscher J,Schlötterer C,Hauser MT
    A single amino acid replacement in ETC2 shapes trichome patterning in natural Arabidopsis populations.
    Curr. Biol., 2009. 19(20): p. 1747-51
    [PMID:19818620]
  3. Yu N, et al.
    Temporal control of trichome distribution by microRNA156-targeted SPL genes in Arabidopsis thaliana.
    Plant Cell, 2010. 22(7): p. 2322-35
    [PMID:20622149]
  4. Gan L,Xia K,Chen JG,Wang S
    Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis.
    BMC Plant Biol., 2011. 11: p. 176
    [PMID:22168948]
  5. Tominaga-Wada R,Nukumizu Y
    Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis.
    Int J Mol Sci, 2012. 13(3): p. 3478-91
    [PMID:22489163]
  6. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  7. Tominaga-Wada R,Nukumizu Y,Sato S,Wada T
    Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor.
    PLoS ONE, 2013. 8(1): p. e54019
    [PMID:23326563]
  8. Nukumizu Y,Wada T,Tominaga-Wada R
    Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation.
    Plant Signal Behav, 2013. 8(7): p. e24575
    [PMID:23603939]
  9. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]